P19 L78W 1 Peptide sequence KEEWEKQKAELQQEVEKLASENASMKLELDAL Purity 95percentage,... Tender

DIRECTORATE OF PURCHASE AND STORES, DAE has floated a tender for P19 L78W 1 Peptide sequence KEEWEKQKAELQQEVEKLASENASMKLELDAL Purity 95percentage, Qty: 5 MILLIGRAM, (BOQ Item #2). The project location is Mumbai, Maharashtra, India. The reference number is - and it is closing on 24 Oct 2025. Suppliers can request Register free of cost to get the complete Tender details and download the document.

Procurement Summary

State: Maharashtra

Summary: P19 L78W 1 Peptide sequence KEEWEKQKAELQQEVEKLASENASMKLELDAL Purity 95percentage, Qty: 5 MILLIGRAM, (BOQ Item #2)

Deadline: 24 Oct 2025

Other Information

Notice Type: Tender

TOT Ref.No.: 127481735

Document Ref. No.: Login to see detail

Financier: Self Financed

Purchaser Ownership: Public

Document Fees: Refer Document

Tender Value: Refer Document

EMD: Refer Document

Purchaser's Detail

Name: Login to see details

Address: Login to see details

Email: Login to see details

  Login to see details

Documents

 Tender Notice

Bid_Document_8302513.pdf

Specification_Document.pdf

BOQ_Document.csv


Browse More

Emudhra