DIRECTORATE OF PURCHASE AND STORES, DAE has floated a tender for P19 A92W 1 Peptide sequence KEELEKQKAELQQEVEKLWSENASMKLELDAL Purity 95percentage, Qty: 5 MILLIGRAM, (BOQ Item #4). The project location is Mumbai, Maharashtra, India. The reference number is - and it is closing on 24 Oct 2025.
Suppliers can request Register free of cost to get the complete Tender details and download the document.